Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Amyloid beta-Protein (40-1)
pr

Amyloid beta-Protein (40-1)

BGC Id:701646641936
CAS No:144409-99-4
Synonyms:l-aspartic acid,l-valyl-l-valylglycylglycyl-l-valyl-l-methionyl-l-leucylglycyl-l-isoleucyl-l-isoleucyl-l-alanylglycyl-l-lysyl-l-asparaginyl-l-serylglycyl-l-valyl-l-a-aspartyl-l-a-glutamyl-l-alanyl-l-phenylalanyl-l-phenylalanyl-l-valyl-l-leucyl-l-lysyl-l-glutaminyl-l-histidyl-l-histidyl-l-valyl-l-a-glutamyl-l-tyrosylglycyl-l-seryl-l-a-aspartyl-l-histidyl-l-arginyl-l-phenylalanyl-l-a-glutamyl-l-alanyl- ; amyloid β-protein (40-1) ; human b-amyloid peptide-(40-1) ; amyloid beta-protein (40-1) ; amyloid β-protein fragment 40-1 ; amyloid beta-protein fragment 40-1 ; 766: pn: us20090175821 seqid: 960claimed protein ; vvggvmlgiiagknsgvdeaffvlkqhhveygsdhrfead ; amyloid b-protein (40-1) ; 280:pn: wo0069900 seqid: 960 unclaimed protein ; amyloid beta-protein (40-1) trifluoroacetate ; amyloid b-protein, fragment 40-1 ; amyloid b-protein ; beta-amyloid (40-1)
Molecular Formula:C194H295 N53 O58 S
Molecular Weight:4329.8
EINECS:
Structural Formula

The most competitive supplier in 2025

The following 2 notable providers have been checked and can be recommended.
Chemical-Suppliers
Leap Chem
Molecular Formula: C194H295N53O58S Molecular Weight: 4329.8034 WGKGermany: 3

The last intensive check and update was carried out on 2025/10/30.

Identify

Synonyms:
l-aspartic acid,l-valyl-l-valylglycylglycyl-l-valyl-l-methionyl-l-leucylglycyl-l-isoleucyl-l-isoleucyl-l-alanylglycyl-l-lysyl-l-asparaginyl-l-serylglycyl-l-valyl-l-a-aspartyl-l-a-glutamyl-l-alanyl-l-phenylalanyl-l-phenylalanyl-l-valyl-l-leucyl-l-lysyl-l-glutaminyl-l-histidyl-l-histidyl-l-valyl-l-a-glutamyl-l-tyrosylglycyl-l-seryl-l-a-aspartyl-l-histidyl-l-arginyl-l-phenylalanyl-l-a-glutamyl-l-alanyl- ; amyloid β-protein (40-1) ; human b-amyloid peptide-(40-1) ; amyloid beta-protein (40-1) ; amyloid β-protein fragment 40-1 ; amyloid beta-protein fragment 40-1 ; 766: pn: us20090175821 seqid: 960claimed protein ; vvggvmlgiiagknsgvdeaffvlkqhhveygsdhrfead ; amyloid b-protein (40-1) ; 280:pn: wo0069900 seqid: 960 unclaimed protein ; amyloid beta-protein (40-1) trifluoroacetate ; amyloid b-protein, fragment 40-1 ; amyloid b-protein ; beta-amyloid (40-1)
CAS:
144409-99-4
EINECS:
Molecular Formula:
C194H295 N53 O58 S
MDL:

Properties

Molecular Weight:
4329.8 g·mol−1

Suppliers

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Additionally 3-Hexadecanol is supplied by us. Our client list includes many major pharmac ...
Country: P.R.China   Phone: +852-30606658  

BuGuCh & Partners

Company type: Producer
Country: Germany
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C

What other providers are available for CAS 144409-99-4?

In addition to the providers presented here for Amyloid beta-Protein (40-1) with the CAS number 144409-99-4, there are other 8 providers with slightly different product names available for this CAS number.

+1 additional providers that we know from the past
+1 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.