|
|
|
Leap Chem Co., Ltdis a supplier of
|
|
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 |
|
|
This listing includes other chemicals and chemical products supplied by Leap Chem Co., Ltd.
Click the line at a product and you will get the email form to send an inquiry.
|
|
|
Product names |
CAS numbers |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
Information on Leap Chem Co., Ltd |
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 5,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many major pharmaceutical and science companies, universities, research institutions and chemical catalogue companies.
Methodology: Sound and Stable;Active and Innovative.
Attitude: Conscientious; Ingenious.
Goals: Customer’s Satisfaction
We regard client’s success as our success.
At LEAPChem we strive to be the preferred supplier for efficiency increasing and cost lowering in your Research&Production.
To achieve this strategic vision, we always push ourself to exceed our customer's requirement. By focusing 'Beyond Your Expectation' we continually expand our product line, enhance our systematic management and human resources.
Welcome to contact us and we look forward to becoming your preferred partner.
|
Leap Chem Co., Ltd also offers: Ftivazide FTIDC Fti-277 hydrochloride FTI-277 FTI 276 Fthalide FTBMT Ftaxilide FTASE inhibitor III Ftalofyne Ft-113 Ft-008 Fsof protein Fsoe protein Fsl-1 lipoprotein, synthetic Fsk-508 Fsh-beta(81-95) Fsh-beta(51-65) Fsh-beta(1-15) FSH Receptor-Binding Inhibitor Fragment (BI-10) FSCPX Fs-2 Fs(1)ya protein FS SOHQ-6C FS SAMSA-6A FS SAAM-6C Fs 205-397 Frx b protein Frutinone A Frur protein Fruquintinib|hmpl-013 Frumil Frullanolide Fruglamin Fructus psoraleae Fructosylvaline Fructosyltransferase, sucrose 1f- Fructosyl-methionine Fructosyl-lysine Fructosyl-glycine Fructosyl-amino acid oxidase Fructose-phenylalanine Fructose-leucine (mixture of diastereomers) Fructose-isoleucine (mixture of diastereomers) Fructose-asparagine (mixture of diastereomers) Fructose-alanine (mixture of diastereomers) Fructose-6-phosphate Fructose-2-phosphate Fructose-1-S-nitroso-N-acetyl-D,L-penicillamine Fructose-1-phosphate barium salt
|
|
|
|
|
|
|