|
Information on Leap Chem Co., Ltd |
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 5,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many major pharmaceutical and science companies, universities, research institutions and chemical catalogue companies.
Methodology: Sound and Stable;Active and Innovative.
Attitude: Conscientious; Ingenious.
Goals: Customer’s Satisfaction
We regard client’s success as our success.
At LEAPChem we strive to be the preferred supplier for efficiency increasing and cost lowering in your Research&Production.
To achieve this strategic vision, we always push ourself to exceed our customer's requirement. By focusing 'Beyond Your Expectation' we continually expand our product line, enhance our systematic management and human resources.
Welcome to contact us and we look forward to becoming your preferred partner.
|
Leap Chem Co., Ltd also offers: Fugapavine Fuels, diesel, no. 2 Fuel oil no. 5 Fuel gases, water gas Fuegin Fudosteine impurity 2 Fudosteine Fucus vesiculosus, ext. Fucus serratus, ext Fuctinin Fucoxanthin Fucosyllacto-N-hexaose III from human Fucosylgloboside Fucosylceramide Fucosyl-N-acetylglucosaminylasparagine Fucosterol epoxide Fucosterol Fucoside b Fucoserratene,(3E,5E)-1,3,5-octatriene,(E,z)-1,3,5-octatriene Fucose, L-, [6-3H] Fucose Fucoidan Fucogalactan Fuco-4-O-methylglucuronoxylan Fuchsin basic Fuchsin basic Fuchsin acid Fuchselin Fuc-alpha1,2gal-beta1,3galnac-beta1,4(neu5ac-alpha2,3)gal-beta1,4glc-beta1,1 ceramide, nh4, bovine Fubrogonium Fuberidazole Fty720-d4 hydrochloride FTY720 Phosphate Fty720 octanoic acid hydrochloride Fty720 hexanoic acid hydrochloride Fty720 butanoic acid hydrochloride FTY720 (S)-Phosphate FTY720 (R)-Phosphate Ftt Ftsw protein Ftse protein Ftorpropazine Ftormetazine Ftorlak FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 Ftivazide FTIDC Fti-277 hydrochloride FTI-277 FTI 276
|
|