|
|
|
Charybdotoxin
Synonyms: charybdotoxin (reduced),cyclic (7® | charybdotoxin
chtx | charybdotoxin, recombinant, e coli | m.w. 4295.89 c176h277n57o55s7 | rchtx | 33),(17® | charybdotoxin | 33,34,70,71,95,96-hexathia-2,5,8,11,14,17,20,23,26,29,37,40,43,46,49,52,55,58,61,64,67,74,77,80,83,86,89,92-octacosaazatricyclo[34.32.25.413,79]heptanonacontane,cyclic peptide deriv. | 36: pn: wo2006116156 seqid: 36 claimed protein | 35)-tris(disulfide) | rcharybdotoxin | chtx | charybdotoxin, recombinant | charybdotoxin, leiurus quinquestriatus hebraeus | charybdotoxin (leiurus quinquestriatus hebraeus) | 28),(13® | pyr-ftnvscttskecwsvcqrlhntsrgkcmnkkcrcys
Formula: C176H277 N57 O55 S7
List of Suppliers
Alpha Biopharmaceuticals Co., Ltd.
Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. Alpha Biopharmaceuticals Co., Ltd. is supplier for Charybdotoxin. We supply our chemical product Boc-L-Orn(Dde)-OH. Moreover, we are focused on nucleic acid and other small organic compounds. Alabiochem company not only provides contact research but custom synthesis service.
Country: P.R.China
Phone: +86-411-39042497
Telefax: +86-411-39042693
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. Bachem AG is supplier for Charybdotoxin. We are seller of Suc-Leu-Leu-Val-Tyr-pNA. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
BOC Sciences
Company type: Supplier
BOC Sciences provides a wide range of customer services, bulk and specialty compounds to the pharmaceutical, agrochemical and biotechnology industries. BOC Sciences is supplier for Charybdotoxin. We supply our chemical product . We intend to offer you the products and services of the highest quality at the most reasonable, cost efficient prices. Most of our compounds can be supplied ranging from mg to kg and arrive with analytic report. We hope to add immense value to your research projects!
Country: USA
Phone: +1-631-485-4226
Telefax: +1-631-614-7828
Santa Cruz Biotechnology, Inc.
Company type: International Supplier
Santa Cruz Biotechnology, Inc. now offers over 140,000 specialty biochemicals under our ChemCruz™ brand. Santa Cruz Biotechnology, Inc. also offers 2-Chloro-6-nitrophenol. Santa Cruz Biotechnology, Inc. is supplier for Charybdotoxin.
Santa Cruz Biotechnology, Inc. is focused on the ongoing development of research reagents. It is our goal to continue to offer the broadest range of reagents in the field. We also provide superior, innovative primary antibodies and support products.
Country: USA
Phone: +1 800-457-3802
Telefax: +1-831-457-3802
Hangzhou Dayangchem Co. Ltd.
Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. Suberic acid di(2-ethylhexyl) ester will be also provided by us. Hangzhou Dayangchem Co. Ltd. is supplier for Charybdotoxin. We act also as agent of many chemical factories and promote their products to the international market at very competitive price.
We take "Credi first, Clients supreme" as our aim. We expect to cooperate with more partners ...
Country: P.R.China
Phone: +86-571-88938639
Telefax: +86-571-8893-8652
Chemos GmbH & Co. KG
Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Additionally Arsenic acid, sodium salt is supplied by us. Chemos GmbH & Co. KG is supplier for Charybdotoxin. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany
Phone: +49-871-966346-0
Telefax: +49-871-966346-13
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Charybdotoxin. BuGuCh & Partners also offers (2-Ethylhexanoato-o)(isodecanoato-o)cobalt. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Additionally 1H-Benz[g]indole-2,3-dione is supplied by us. Leap Chem Co., Ltd is supplier for Charybdotoxin.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Specification
Solubility: Solution at 1 mg/ml in Water
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Related products:
|
|
|
How do you find
new customers?
click here
Vistachem Europe GmbH
As reliable providers of chemicals from across the globe, our world-wide web sources and supplies t
Codexis, Inc.
Is a world leader in providing unique, state-of-the-art enzyme optimization services and developing
Corvay Specialty Chemic
Corvay Specialty Chemicals GmbH distributes high quality specialty chemicals from selected manufact
polypeptide.ltd
Xuchang Shangke Chemical Co., Ltd. (Phcoker / Polypeptide.ltd) was founded in 2008, located in the
Shandong Shimizu Chemic
Japan-China Joint Venture enterprise, mainly produce Dimethyl Isophthalate and polymerizable esters
Wuhan Alpha & Omega Pha
This is Wuhan Alpha & Omega Pharmaceuticals LTD. We are located in Hubei province of China. We
|
